SCOPe 2.02: Domain d2ewna2: 2ewn A:271-317

Lineage for d2ewna2 (2ewn A:271-317)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.1: C-terminal domain of transcriptional repressors [50037] (3 families)
   the N-terminal domains of these repressors bind DNA

5. Family b.34.1.1: Biotin repressor (BirA) [50038] (2 proteins)

6. Protein Biotin repressor/biotin holoenzyme synthetase, C-terminal domain [50039] (1 species)

7. Species Escherichia coli [TaxId:562] [50040] (4 PDB entries)

8. Domain d2ewna2: 2ewn A:271-317 [132471]
   Other proteins in same PDB: d2ewna1, d2ewna3, d2ewnb1, d2ewnb3
   automatically matched to d1bia_2
   complexed with btx

Details for d2ewna2

PDB Entry: 2ewn, 2.8 Å

PDB Description: Ecoli Biotin Repressor with co-repressor analog

PDB Compounds: (A:) BirA BIFUNCTIONAL PROTEIN

SCOPe Domain Sequences for d2ewna2:

Sequence; same for both SEQRES and ATOM records:

>d2ewna2 b.34.1.1 (A:271-317) Biotin repressor/biotin holoenzyme synthetase, C-terminal domain {Escherichia coli [TaxId: 562]}
finrpvkliigdkeifgisrgidkqgallleqdgiikpwmggeislr

Timeline for d2ewna2:

• d2ewna2 first appeared in SCOP 1.73
  
• d2ewna2 appears in SCOPe 2.01
  
• d2ewna2 appears in SCOPe 2.03
  
• d2ewna2 appears in the current release, SCOPe 2.08