Lineage for d2ewna2 (2ewn A:271-317)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 796060Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 796061Superfamily b.34.1: C-terminal domain of transcriptional repressors [50037] (3 families) (S)
    the N-terminal domains of these repressors bind DNA
  5. 796062Family b.34.1.1: Biotin repressor (BirA) [50038] (2 proteins)
  6. 796063Protein Biotin repressor/biotin holoenzyme synthetase, C-terminal domain [50039] (1 species)
  7. 796064Species Escherichia coli [TaxId:562] [50040] (4 PDB entries)
  8. 796068Domain d2ewna2: 2ewn A:271-317 [132471]
    Other proteins in same PDB: d2ewna1, d2ewna3, d2ewnb1, d2ewnb3
    automatically matched to d1bia_2
    complexed with btx

Details for d2ewna2

PDB Entry: 2ewn (more details), 2.8 Å

PDB Description: Ecoli Biotin Repressor with co-repressor analog
PDB Compounds: (A:) BirA BIFUNCTIONAL PROTEIN

SCOP Domain Sequences for d2ewna2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ewna2 b.34.1.1 (A:271-317) Biotin repressor/biotin holoenzyme synthetase, C-terminal domain {Escherichia coli [TaxId: 562]}
finrpvkliigdkeifgisrgidkqgallleqdgiikpwmggeislr

SCOP Domain Coordinates for d2ewna2:

Click to download the PDB-style file with coordinates for d2ewna2.
(The format of our PDB-style files is described here.)

Timeline for d2ewna2: