![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins) also known as short-chain dehydrogenases and SDR family parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7 |
![]() | Protein (s)-1-phenylethanol dehydrogenase [141902] (1 species) |
![]() | Species Azoarcus sp. ebn1 [TaxId:76114] [141903] (2 PDB entries) Uniprot Q5P5I4 3-249 |
![]() | Domain d2ewmb1: 2ewm B:3-249 [132469] automatically matched to 2EW8 A:3-249 complexed with nad, so4 |
PDB Entry: 2ewm (more details), 2.4 Å
SCOPe Domain Sequences for d2ewmb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ewmb1 c.2.1.2 (B:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} qrlkdklavitggangigraiaerfavegadiaiadlvpapeaeaairnlgrrvltvkcd vsqpgdveafgkqvistfgrcdilvnnagiyplipfdeltfeqwkktfeinvdsgflmak afvpgmkrngwgriinltsttywlkieaythyistkaanigftralasdlgkdgitvnai apslvrtatteasalsamfdvlpnmlqaiprlqvpldltgaaaflasddasfitgqtlav dggmvrh
Timeline for d2ewmb1: