![]() | Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
![]() | Fold e.2: Replication terminator protein (Tus) [56595] (1 superfamily) contains a cluster of helices and a beta-sandwich |
![]() | Superfamily e.2.1: Replication terminator protein (Tus) [56596] (1 family) ![]() automatically mapped to Pfam PF05472 |
![]() | Family e.2.1.1: Replication terminator protein (Tus) [56597] (1 protein) |
![]() | Protein Replication terminator protein (Tus) [56598] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [56599] (4 PDB entries) |
![]() | Domain d2ewja_: 2ewj A: [132467] automated match to d1ecra_ protein/DNA complex; complexed with iod |
PDB Entry: 2ewj (more details), 2.7 Å
SCOPe Domain Sequences for d2ewja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ewja_ e.2.1.1 (A:) Replication terminator protein (Tus) {Escherichia coli [TaxId: 562]} dlvdrlnttfrqmeqelaifaahleqhkllvarvfslpevkkedehnplnrievkqhlgn daqslalrhfrhlfiqqqsenrsskaavrlpgvlcyqvdnlsqaalvshiqhinklkttf ehivtveselptaarfewvhrhlpglitlnayrtltvlhdpatlrfgwankhiiknlhrd evlaqlekslksprsvapwtreewqrklereyqdiaalpqnaklkikrpvkvqpiarvwy kgdqkqvqhacptplialinrdngagvpdvgellnydadnvqhrykpqaqplrliiprlh lyvad
Timeline for d2ewja_: