![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.56: CcmK-like [143414] (2 families) ![]() contains extra C-terminal helix; forms compact hexameric 'tiles' of hexagonal shape |
![]() | Family d.58.56.1: CcmK-like [143415] (4 proteins) Pfam PF00936; BMC domain |
![]() | Protein Major carboxysome shell protein 1A, CsoS1A [143416] (1 species) |
![]() | Species Halothiobacillus neapolitanus [TaxId:927] [143417] (2 PDB entries) Uniprot P45689 5-97 |
![]() | Domain d2ewha1: 2ewh A:6-98 [132466] complexed with edo, trs |
PDB Entry: 2ewh (more details), 1.4 Å
SCOPe Domain Sequences for d2ewha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ewha1 d.58.56.1 (A:6-98) Major carboxysome shell protein 1A, CsoS1A {Halothiobacillus neapolitanus [TaxId: 927]} gialgmietrglvpaieaadamtkaaevrlvgrqfvgggyvtvlvrgetgavnaavraga dacervgdglvaahiiarvhsevenilpkapqa
Timeline for d2ewha1: