Lineage for d2ewha1 (2ewh A:6-98)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2955934Superfamily d.58.56: CcmK-like [143414] (2 families) (S)
    contains extra C-terminal helix; forms compact hexameric 'tiles' of hexagonal shape
  5. 2955935Family d.58.56.1: CcmK-like [143415] (4 proteins)
    Pfam PF00936; BMC domain
  6. 2955965Protein Major carboxysome shell protein 1A, CsoS1A [143416] (1 species)
  7. 2955966Species Halothiobacillus neapolitanus [TaxId:927] [143417] (2 PDB entries)
    Uniprot P45689 5-97
  8. 2955967Domain d2ewha1: 2ewh A:6-98 [132466]
    complexed with edo, trs

Details for d2ewha1

PDB Entry: 2ewh (more details), 1.4 Å

PDB Description: carboxysome protein csos1a from halothiobacillus neapolitanus
PDB Compounds: (A:) Major carboxysome shell protein 1A

SCOPe Domain Sequences for d2ewha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ewha1 d.58.56.1 (A:6-98) Major carboxysome shell protein 1A, CsoS1A {Halothiobacillus neapolitanus [TaxId: 927]}
gialgmietrglvpaieaadamtkaaevrlvgrqfvgggyvtvlvrgetgavnaavraga
dacervgdglvaahiiarvhsevenilpkapqa

SCOPe Domain Coordinates for d2ewha1:

Click to download the PDB-style file with coordinates for d2ewha1.
(The format of our PDB-style files is described here.)

Timeline for d2ewha1: