Lineage for d2ewcj1 (2ewc J:3-122)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 727288Fold d.79: Bacillus chorismate mutase-like [55297] (7 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 727289Superfamily d.79.1: YjgF-like [55298] (2 families) (S)
    forms trimers with three closely packed beta-sheets; possibly related to the IspF (d.79.5) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)
  5. 727290Family d.79.1.1: YjgF/L-PSP [55299] (10 proteins)
    some members possess an endoribonuclease activity inhibiting mRNA translation
  6. 727329Protein Hypothetical protein SPy2060 [143527] (1 species)
  7. 727330Species Streptococcus pyogenes [TaxId:1314] [143528] (1 PDB entry)
  8. 727340Domain d2ewcj1: 2ewc J:3-122 [132463]
    automatically matched to 2EWC A:3-122
    complexed with gol

Details for d2ewcj1

PDB Entry: 2ewc (more details), 2.15 Å

PDB Description: structure of hypothetical protein from streptococcus pyogenes m1 gas, member of highly conserved yjgf family of proteins
PDB Compounds: (J:) conserved hypothetical protein

SCOP Domain Sequences for d2ewcj1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ewcj1 d.79.1.1 (J:3-122) Hypothetical protein SPy2060 {Streptococcus pyogenes [TaxId: 1314]}
tirrydvnedrghtglveagdfyylnycvgnvgqdiesqingafdemerrlalvgltlda
vvqmdclfrdvwnipvmekmikerfngryparksiqtefahhggpqgllfqvdgvayskh

SCOP Domain Coordinates for d2ewcj1:

Click to download the PDB-style file with coordinates for d2ewcj1.
(The format of our PDB-style files is described here.)

Timeline for d2ewcj1: