![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.79: Bacillus chorismate mutase-like [55297] (7 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
![]() | Superfamily d.79.1: YjgF-like [55298] (2 families) ![]() forms trimers with three closely packed beta-sheets; possibly related to the IspF (d.79.5) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1) |
![]() | Family d.79.1.1: YjgF/L-PSP [55299] (10 proteins) some members possess an endoribonuclease activity inhibiting mRNA translation |
![]() | Protein Hypothetical protein SPy2060 [143527] (1 species) |
![]() | Species Streptococcus pyogenes [TaxId:1314] [143528] (1 PDB entry) |
![]() | Domain d2ewcj1: 2ewc J:3-122 [132463] automatically matched to 2EWC A:3-122 complexed with gol |
PDB Entry: 2ewc (more details), 2.15 Å
SCOP Domain Sequences for d2ewcj1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ewcj1 d.79.1.1 (J:3-122) Hypothetical protein SPy2060 {Streptococcus pyogenes [TaxId: 1314]} tirrydvnedrghtglveagdfyylnycvgnvgqdiesqingafdemerrlalvgltlda vvqmdclfrdvwnipvmekmikerfngryparksiqtefahhggpqgllfqvdgvayskh
Timeline for d2ewcj1: