Lineage for d2ewcg_ (2ewc G:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958618Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2958619Superfamily d.79.1: YjgF-like [55298] (4 families) (S)
    forms trimers with three closely packed beta-sheets; possibly related to the IspF (d.79.5) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)
  5. 2958620Family d.79.1.1: YjgF/L-PSP [55299] (12 proteins)
    some members possess an endoribonuclease activity inhibiting mRNA translation
  6. 2958664Protein Hypothetical protein SPy2060 [143527] (1 species)
  7. 2958665Species Streptococcus pyogenes [TaxId:1314] [143528] (1 PDB entry)
    Uniprot Q99XS4 3-122
  8. 2958672Domain d2ewcg_: 2ewc G: [132460]
    automated match to d2ewca1
    complexed with gol

Details for d2ewcg_

PDB Entry: 2ewc (more details), 2.15 Å

PDB Description: structure of hypothetical protein from streptococcus pyogenes m1 gas, member of highly conserved yjgf family of proteins
PDB Compounds: (G:) conserved hypothetical protein

SCOPe Domain Sequences for d2ewcg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ewcg_ d.79.1.1 (G:) Hypothetical protein SPy2060 {Streptococcus pyogenes [TaxId: 1314]}
tirrydvnedrghtglveagdfyylnycvgnvgqdiesqingafdemerrlalvgltlda
vvqmdclfrdvwnipvmekmikerfngryparksiqtefahhggpqgllfqvdgvayskh

SCOPe Domain Coordinates for d2ewcg_:

Click to download the PDB-style file with coordinates for d2ewcg_.
(The format of our PDB-style files is described here.)

Timeline for d2ewcg_: