![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.50: Macro domain-like [52948] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 6 strands, order 165243, strand 3 is antiparallel to the rest |
![]() | Superfamily c.50.1: Macro domain-like [52949] (4 families) ![]() |
![]() | Family c.50.1.0: automated matches [191326] (1 protein) not a true family |
![]() | Protein automated matches [190146] (12 species) not a true protein |
![]() | Species Cow (Bos taurus) [TaxId:9913] [255154] (2 PDB entries) |
![]() | Domain d2ewba2: 2ewb A:1-159 [132453] Other proteins in same PDB: d2ewba1 automated match to d1lama2 complexed with co3, mpd, na, zed, zn |
PDB Entry: 2ewb (more details), 1.85 Å
SCOPe Domain Sequences for d2ewba2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ewba2 c.50.1.0 (A:1-159) automated matches {Cow (Bos taurus) [TaxId: 9913]} tkglvlgiyskekeedepqftsagenfnklvsgklreilnisgpplkagktrtfyglhed fpsvvvvglgkktagideqenwhegkeniraavaagcrqiqdleipsvevdpcgdaqaaa egavlglyeyddlkqkrkvvvsaklhgsedqeawqrgvl
Timeline for d2ewba2: