Lineage for d2ewba2 (2ewb A:1-159)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2881110Fold c.50: Macro domain-like [52948] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 6 strands, order 165243, strand 3 is antiparallel to the rest
  4. 2881111Superfamily c.50.1: Macro domain-like [52949] (4 families) (S)
  5. 2881815Family c.50.1.0: automated matches [191326] (1 protein)
    not a true family
  6. 2881816Protein automated matches [190146] (12 species)
    not a true protein
  7. 2881825Species Cow (Bos taurus) [TaxId:9913] [255154] (2 PDB entries)
  8. 2881827Domain d2ewba2: 2ewb A:1-159 [132453]
    Other proteins in same PDB: d2ewba1
    automated match to d1lama2
    complexed with co3, mpd, na, zed, zn

Details for d2ewba2

PDB Entry: 2ewb (more details), 1.85 Å

PDB Description: the crystal structure of bovine lens leucine aminopeptidase in complex with zofenoprilat
PDB Compounds: (A:) cytosol aminopeptidase

SCOPe Domain Sequences for d2ewba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ewba2 c.50.1.0 (A:1-159) automated matches {Cow (Bos taurus) [TaxId: 9913]}
tkglvlgiyskekeedepqftsagenfnklvsgklreilnisgpplkagktrtfyglhed
fpsvvvvglgkktagideqenwhegkeniraavaagcrqiqdleipsvevdpcgdaqaaa
egavlglyeyddlkqkrkvvvsaklhgsedqeawqrgvl

SCOPe Domain Coordinates for d2ewba2:

Click to download the PDB-style file with coordinates for d2ewba2.
(The format of our PDB-style files is described here.)

Timeline for d2ewba2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ewba1