Lineage for d2ewba1 (2ewb A:160-486)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2887810Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2889494Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families) (S)
    core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest
  5. 2889696Family c.56.5.3: Leucine aminopeptidase, C-terminal domain [53201] (2 proteins)
    automatically mapped to Pfam PF00883
  6. 2889720Protein automated matches [254524] (1 species)
    not a true protein
  7. 2889721Species Cow (Bos taurus) [TaxId:9913] [255155] (2 PDB entries)
  8. 2889723Domain d2ewba1: 2ewb A:160-486 [132452]
    Other proteins in same PDB: d2ewba2
    automated match to d1lama1
    complexed with co3, mpd, na, zed, zn

Details for d2ewba1

PDB Entry: 2ewb (more details), 1.85 Å

PDB Description: the crystal structure of bovine lens leucine aminopeptidase in complex with zofenoprilat
PDB Compounds: (A:) cytosol aminopeptidase

SCOPe Domain Sequences for d2ewba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ewba1 c.56.5.3 (A:160-486) automated matches {Cow (Bos taurus) [TaxId: 9913]}
fasgqnlarrlmetpanemtptkfaeiveenlksasiktdvfirpkswieeqemgsflsv
akgseeppvfleihykgspnasepplvfvgkgitfdsggisikaaanmdlmradmggaat
icsaivsaakldlpinivglaplcenmpsgkankpgdvvrarngktiqvdntdaegrlil
adalcyahtfnpkviinaatltgamdialgsgatgvftnsswlwnklfeasietgdrvwr
mplfehytrqvidcqladvnnigkyrsagactaaaflkefvthpkwahldiagvmtnkde
vpylrkgmagrptrtlieflfrfsqds

SCOPe Domain Coordinates for d2ewba1:

Click to download the PDB-style file with coordinates for d2ewba1.
(The format of our PDB-style files is described here.)

Timeline for d2ewba1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ewba2