Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families) core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest |
Family c.56.5.3: Leucine aminopeptidase, C-terminal domain [53201] (2 proteins) automatically mapped to Pfam PF00883 |
Protein automated matches [254524] (1 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [255155] (2 PDB entries) |
Domain d2ewba1: 2ewb A:160-486 [132452] Other proteins in same PDB: d2ewba2 automated match to d1lama1 complexed with co3, mpd, na, zed, zn |
PDB Entry: 2ewb (more details), 1.85 Å
SCOPe Domain Sequences for d2ewba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ewba1 c.56.5.3 (A:160-486) automated matches {Cow (Bos taurus) [TaxId: 9913]} fasgqnlarrlmetpanemtptkfaeiveenlksasiktdvfirpkswieeqemgsflsv akgseeppvfleihykgspnasepplvfvgkgitfdsggisikaaanmdlmradmggaat icsaivsaakldlpinivglaplcenmpsgkankpgdvvrarngktiqvdntdaegrlil adalcyahtfnpkviinaatltgamdialgsgatgvftnsswlwnklfeasietgdrvwr mplfehytrqvidcqladvnnigkyrsagactaaaflkefvthpkwahldiagvmtnkde vpylrkgmagrptrtlieflfrfsqds
Timeline for d2ewba1: