Lineage for d2ewaa1 (2ewa A:5-354)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1220003Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1220004Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1220070Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1221011Protein MAP kinase p38 [56129] (2 species)
    CMGC group; ERK/MAPK subfamily; serine/threonine kinase
  7. 1221147Species Mouse (Mus musculus) [TaxId:10090] [56131] (20 PDB entries)
  8. 1221156Domain d2ewaa1: 2ewa A:5-354 [132451]
    automatically matched to d1a9u__
    complexed with sb2

Details for d2ewaa1

PDB Entry: 2ewa (more details), 2.1 Å

PDB Description: Dual binding mode of pyridinylimidazole to MAP kinase p38
PDB Compounds: (A:) Mitogen-activated protein kinase 14

SCOPe Domain Sequences for d2ewaa1:

Sequence, based on SEQRES records: (download)

>d2ewaa1 d.144.1.7 (A:5-354) MAP kinase p38 {Mouse (Mus musculus) [TaxId: 10090]}
rptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkklsrpfqsiih
akrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcqkltd
dhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarhtddemtgyva
trwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpga
ellkkissesarnyiqsltqmpkmnfanvfiganplavdllekmlvldsdkritaaqala
hayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvpppld

Sequence, based on observed residues (ATOM records): (download)

>d2ewaa1 d.144.1.7 (A:5-354) MAP kinase p38 {Mouse (Mus musculus) [TaxId: 10090]}
rptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkklsrpfqsiih
akrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnniltddhvqf
liyqilrglkyihsadiihrdlkpsnlavnedcelkildfgtrwyrapeimlnmhynqtv
diwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpgaellkkissesarnyiqsltq
mpkmnfanvfiganplavdllekmlvldsdkritaaqalahayfaqyhdpddepvadpyd
qsfesrdllidewksltydevisfvpppld

SCOPe Domain Coordinates for d2ewaa1:

Click to download the PDB-style file with coordinates for d2ewaa1.
(The format of our PDB-style files is described here.)

Timeline for d2ewaa1: