Lineage for d2ew8d_ (2ew8 D:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 975118Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 975119Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 978249Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 978250Protein automated matches [190069] (51 species)
    not a true protein
  7. 978276Species Azoarcus sp. [TaxId:76114] [187073] (1 PDB entry)
  8. 978279Domain d2ew8d_: 2ew8 D: [132450]
    Other proteins in same PDB: d2ew8a1
    automated match to d1i01a_
    complexed with so4

Details for d2ew8d_

PDB Entry: 2ew8 (more details), 2.1 Å

PDB Description: crystal structure of the (s)-specific 1-phenylethanol dehydrogenase of the denitrifying bacterium strain ebn1
PDB Compounds: (D:) (S)-1-Phenylethanol dehydrogenase

SCOPe Domain Sequences for d2ew8d_:

Sequence, based on SEQRES records: (download)

>d2ew8d_ c.2.1.0 (D:) automated matches {Azoarcus sp. [TaxId: 76114]}
qrlkdklavitggangigraiaerfavegadiaiadlvpapeaeaairnlgrrvltvkcd
vsqpgdveafgkqvistfgrcdilvnnagiyplipfdeltfeqwkktfeinvdsgflmak
afvpgmkrngwgriinltsttywlkieaythyistkaanigftralasdlgkdgitvnai
apslvrtatteasalsamfdvlpnmlqaiprlqvpldltgaaaflasddasfitgqtlav
dggmvrh

Sequence, based on observed residues (ATOM records): (download)

>d2ew8d_ c.2.1.0 (D:) automated matches {Azoarcus sp. [TaxId: 76114]}
qrlkdklavitggangigraiaerfavegadiaiadlvpapeaeaairnlgrrvltvkcd
vsqpgdveafgkqvistfgrcdilvnnagiyplipfdeltfeqwkktfeinvdsgflmak
afvpgmkrngwgriinltsttywlkieaythyistkaanigftralasdlgkdgitvnai
apslvnmlqaiprlqvpldltgaaaflasddasfitgqtlavdggmvrh

SCOPe Domain Coordinates for d2ew8d_:

Click to download the PDB-style file with coordinates for d2ew8d_.
(The format of our PDB-style files is described here.)

Timeline for d2ew8d_: