Lineage for d2ew0a1 (2ew0 A:5-179)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 741694Fold d.310: VC0467-like [143455] (1 superfamily)
    complex fold; contains bifurcated beta-sheet structure folded into pseudo barrel
  4. 741695Superfamily d.310.1: VC0467-like [143456] (1 family) (S)
  5. 741696Family d.310.1.1: VC0467-like [143457] (5 proteins)
    Pfam PF02622; DUF179
  6. 741700Protein Hypothetical protein ACIAD0353 [143464] (1 species)
  7. 741701Species Acinetobacter sp. ADP1 [TaxId:62977] [143465] (1 PDB entry)
  8. 741702Domain d2ew0a1: 2ew0 A:5-179 [132445]
    complexed with so4; mutant

Details for d2ew0a1

PDB Entry: 2ew0 (more details), 1.4 Å

PDB Description: X-ray Crystal Structure of Protein Q6FF54 from Acinetobacter sp. ADP1. Northeast Structural Genomics Consortium Target AsR1.
PDB Compounds: (A:) hypothetical protein ACIAD0353

SCOP Domain Sequences for d2ew0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ew0a1 d.310.1.1 (A:5-179) Hypothetical protein ACIAD0353 {Acinetobacter sp. ADP1 [TaxId: 62977]}
ylthrcliappemaddffantviylarhdeegaqgiiinrpagiqikellndldidadnv
nphevlqggplrpeagfvlhtgqptwhssiavgenvcittskdildaiahnegvgryqia
lgyaswgknqledeiargdwlicdadmdlifnlpyddrwdaaykkigvdrtwlas

SCOP Domain Coordinates for d2ew0a1:

Click to download the PDB-style file with coordinates for d2ew0a1.
(The format of our PDB-style files is described here.)

Timeline for d2ew0a1: