SCOP 1.75: Domain d2evsa1: 2evs A:5-209

Lineage for d2evsa1 (2evs A:5-209)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.224: Glycolipid transfer protein, GLTP [110003] (1 superfamily)
   multihelical; 2 layers or orthogonally packed helices

4. Superfamily a.224.1: Glycolipid transfer protein, GLTP [110004] (1 family)

5. Family a.224.1.1: Glycolipid transfer protein, GLTP [110005] (1 protein)

6. Protein Glycolipid transfer protein, GLTP [110006] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [110007] (7 PDB entries)
   Uniprot Q9NZD2

8. Domain d2evsa1: 2evs A:5-209 [132442]
   automatically matched to d1sx6a_
   complexed with d10, glc, hex

Details for d2evsa1

PDB Entry: 2evs, 2.2 Å

PDB Description: crystal structure of human glycolipid transfer protein complexed with n-hexyl-beta-d-glucoside

PDB Compounds: (A:) glycolipid transfer protein

SCOP Domain Sequences for d2evsa1:

Sequence; same for both SEQRES and ATOM records:

>d2evsa1 a.224.1.1 (A:5-209) Glycolipid transfer protein, GLTP {Human (Homo sapiens) [TaxId: 9606]}
aehllkplpadkqietgpfleavshlppffdclgspvftpikadisgnitkikavydtnp
akfrtlqnilevekemygaewpkvgatlalmwlkrglrfiqvflqsicdgerdenhpnli
rvnatkayemalkkyhgwivqkifqaalyaapyksdflkalskgqnvteeeclekirlfl
vnytatidviyemytqmnaelnykv

Timeline for d2evsa1:

• d2evsa1 first appeared in SCOP 1.73
  
• d2evsa1 is called d2evsa_ in SCOPe 2.01
  
• d2evsa1 appears in the current release, SCOPe 2.08, called d2evsa_