Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (23 families) the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
Family d.3.1.16: NlpC/P60 [142873] (1 protein) Pfam PF00877 |
Protein Cell wall-associated hydrolase Spr C-terminal domain [142874] (1 species) |
Species Nostoc punctiforme [TaxId:272131] [142875] (2 PDB entries) Uniprot Q8YRR4 87-234 |
Domain d2evra2: 2evr A:87-234 [132441] Other proteins in same PDB: d2evra1 complexed with cl, edo, na |
PDB Entry: 2evr (more details), 1.6 Å
SCOPe Domain Sequences for d2evra2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2evra2 d.3.1.16 (A:87-234) Cell wall-associated hydrolase Spr C-terminal domain {Nostoc punctiforme [TaxId: 272131]} tfseseikkllaeviaftqkamqqsnyylwggtvgpnydcsglmqaafasvgiwlprday qqegftqpitiaelvagdlvffgtsqkathvglyladgyyihssgkdqgrdgigidilse qgdavslsyyqqlrgagrvfksyepqrr
Timeline for d2evra2: