![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.11: Prokaryotic SH3-related domain [82057] (5 families) ![]() |
![]() | Family b.34.11.3: Spr N-terminal domain-like [141195] (1 protein) |
![]() | Protein Cell wall-associated hydrolase Spr N-terminal domain [141196] (1 species) |
![]() | Species Nostoc punctiforme [TaxId:272131] [141197] (2 PDB entries) Uniprot Q8YRR4 13-86 |
![]() | Domain d2evra1: 2evr A:13-86 [132440] Other proteins in same PDB: d2evra2 complexed with cl, edo, na |
PDB Entry: 2evr (more details), 1.6 Å
SCOPe Domain Sequences for d2evra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2evra1 b.34.11.3 (A:13-86) Cell wall-associated hydrolase Spr N-terminal domain {Nostoc punctiforme [TaxId: 272131]} klgeyqcladlnlfdspectrlatqsasgrhlwvtsnhqnlavevylceddypgwlslsd fdslqpatvpyqaa
Timeline for d2evra1: