SCOPe 2.01: Domain d2evra1: 2evr A:13-86

Lineage for d2evra1 (2evr A:13-86)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.11: Prokaryotic SH3-related domain [82057] (4 families)

5. Family b.34.11.3: Spr N-terminal domain-like [141195] (1 protein)

6. Protein Cell wall-associated hydrolase Spr N-terminal domain [141196] (1 species)

7. Species Nostoc punctiforme [TaxId:272131] [141197] (2 PDB entries)
   Uniprot Q8YRR4 13-86

8. Domain d2evra1: 2evr A:13-86 [132440]
   Other proteins in same PDB: d2evra2
   complexed with cl, edo, na

Details for d2evra1

PDB Entry: 2evr, 1.6 Å

PDB Description: crystal structure of a putative gamma-d-glutamyl-l-diamino acid endopeptidase (npun_r0659) from nostoc punctiforme pcc 73102 at 1.60 a resolution

PDB Compounds: (A:) COG0791: Cell wall-associated hydrolases (invasion-associated proteins)

SCOPe Domain Sequences for d2evra1:

Sequence; same for both SEQRES and ATOM records:

>d2evra1 b.34.11.3 (A:13-86) Cell wall-associated hydrolase Spr N-terminal domain {Nostoc punctiforme [TaxId: 272131]}
klgeyqcladlnlfdspectrlatqsasgrhlwvtsnhqnlavevylceddypgwlslsd
fdslqpatvpyqaa

Timeline for d2evra1:

• d2evra1 first appeared in SCOP 1.73
  
• d2evra1 appears in SCOP 1.75
  
• d2evra1 appears in SCOPe 2.02
  
• d2evra1 appears in the current release, SCOPe 2.08