![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily) duplication: composed of two very similar alpha+beta folds |
![]() | Superfamily d.127.1: Creatinase/aminopeptidase [55920] (2 families) ![]() |
![]() | Family d.127.1.1: Creatinase/aminopeptidase [55921] (4 proteins) |
![]() | Protein Methionine aminopeptidase [55924] (7 species) |
![]() | Species Escherichia coli [TaxId:562] [55925] (32 PDB entries) Uniprot P07906 |
![]() | Domain d2evob_: 2evo B: [132438] automated match to d1mat__ complexed with co, ct0 |
PDB Entry: 2evo (more details), 1.7 Å
SCOPe Domain Sequences for d2evob_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2evob_ d.127.1.1 (B:) Methionine aminopeptidase {Escherichia coli [TaxId: 562]} siktpediekmrvagrlaaevlemiepyvkpgvstgeldricndyivneqhavsaclgyh gypksvcisinevvchgipddakllkdgdivnidvtvikdgfhgdtskmfivgkptimge rlcritqeslylalrmvkpginlreigaaiqkfveaegfsvvreycghgigrgfheepqv lhydsretnvvlkpgmtftiepmvnagkkeirtmkdgwtvktkdrslsaqyehtivvtdn gceiltlrkddtipaiishd
Timeline for d2evob_: