Lineage for d2evoa_ (2evo A:)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily)
duplication: composed of two very similar alpha+beta foldsSuperfamily d.127.1: Creatinase/aminopeptidase [55920] (2 families) 
Family d.127.1.1: Creatinase/aminopeptidase [55921] (4 proteins) Protein Methionine aminopeptidase [55924] (7 species) 
Species Escherichia coli [TaxId:562] [55925] (32 PDB entries)
Uniprot P07906
Domain d2evoa_: 2evo A: [132437]
automated match to d1mat__
complexed with co, ct0
Details for d2evoa_
PDB Entry: 2evo (more details), 1.7 Å
PDB Description: crystal structure of methionine amino peptidase in complex with N-cyclopentyl-N-(thiazol-2-yl)oxalamide
PDB Compounds: (A:) Methionine aminopeptidaseSCOPe Domain Sequences for d2evoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2evoa_ d.127.1.1 (A:) Methionine aminopeptidase {Escherichia coli [TaxId: 562]}
siktpediekmrvagrlaaevlemiepyvkpgvstgeldricndyivneqhavsaclgyh
gypksvcisinevvchgipddakllkdgdivnidvtvikdgfhgdtskmfivgkptimge
rlcritqeslylalrmvkpginlreigaaiqkfveaegfsvvreycghgigrgfheepqv
lhydsretnvvlkpgmtftiepmvnagkkeirtmkdgwtvktkdrslsaqyehtivvtdn
gceiltlrkddtipaiishd
SCOPe Domain Coordinates for d2evoa_:
Click to download the PDB-style file with coordinates for d2evoa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2evoa_:
- d2evoa_ first appeared in SCOP 1.73, called d2evoa1
- d2evoa_ appears in SCOPe 2.07
View in 3D
