SCOP 1.73: Domain d2evma1: 2evm A:5-262

Lineage for d2evma1 (2evm A:5-262)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily)
   duplication: composed of two very similar alpha+beta folds

4. Superfamily d.127.1: Creatinase/aminopeptidase [55920] (1 family)

5. Family d.127.1.1: Creatinase/aminopeptidase [55921] (3 proteins)

6. Protein Methionine aminopeptidase [55924] (5 species)

7. Species Escherichia coli [TaxId:562] [55925] (29 PDB entries)

8. Domain d2evma1: 2evm A:5-262 [132435]
   automatically matched to d1mat__
   complexed with fc2, mn, na

Details for d2evma1

PDB Entry: 2evm, 1.7 Å

PDB Description: crystal structure of methionine aminopeptidase in complex with 5-(2,5-dichlorophenyl)furan-2-carboxylic acid

PDB Compounds: (A:) Methionine aminopeptidase

SCOP Domain Sequences for d2evma1:

Sequence; same for both SEQRES and ATOM records:

>d2evma1 d.127.1.1 (A:5-262) Methionine aminopeptidase {Escherichia coli [TaxId: 562]}
iktpediekmrvagrlaaevlemiepyvkpgvstgeldricndyivneqhavsaclgyhg
ypksvcisinevvchgipddakllkdgdivnidvtvikdgfhgdtskmfivgkptimger
lcritqeslylalrmvkpginlreigaaiqkfveaegfsvvreycghgigrgfheepqvl
hydsretnvvlkpgmtftiepmvnagkkeirtmkdgwtvktkdrslsaqyehtivvtdng
ceiltlrkddtipaiish

Timeline for d2evma1:

• d2evma1 is new in SCOP 1.73
  
• d2evma1 appears in SCOP 1.75
  
• d2evma1 appears in the current release, SCOPe 2.08, called d2evma_