![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily) duplication: composed of two very similar alpha+beta folds |
![]() | Superfamily d.127.1: Creatinase/aminopeptidase [55920] (1 family) ![]() |
![]() | Family d.127.1.1: Creatinase/aminopeptidase [55921] (3 proteins) |
![]() | Protein Methionine aminopeptidase [55924] (5 species) |
![]() | Species Escherichia coli [TaxId:562] [55925] (29 PDB entries) |
![]() | Domain d2evma1: 2evm A:5-262 [132435] automatically matched to d1mat__ complexed with fc2, mn, na |
PDB Entry: 2evm (more details), 1.7 Å
SCOP Domain Sequences for d2evma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2evma1 d.127.1.1 (A:5-262) Methionine aminopeptidase {Escherichia coli [TaxId: 562]} iktpediekmrvagrlaaevlemiepyvkpgvstgeldricndyivneqhavsaclgyhg ypksvcisinevvchgipddakllkdgdivnidvtvikdgfhgdtskmfivgkptimger lcritqeslylalrmvkpginlreigaaiqkfveaegfsvvreycghgigrgfheepqvl hydsretnvvlkpgmtftiepmvnagkkeirtmkdgwtvktkdrslsaqyehtivvtdng ceiltlrkddtipaiish
Timeline for d2evma1: