SCOP 1.73: Domain d2evka1: 2evk A:1-152

Lineage for d2evka1 (2evk A:1-152)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (26 proteins)
   Heme-binding protein

6. Protein Myoglobin [46469] (9 species)

7. Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (173 PDB entries)

8. Domain d2evka1: 2evk A:1-152 [132433]
   automatically matched to d1dtma_
   complexed with acy, hem; mutant

Details for d2evka1

PDB Entry: 2evk, 1.4 Å

PDB Description: the structures of thiolate- and carboxylate-ligated ferric h93g myoglobin: models for cytochrome p450 and for oxyanion-bound heme proteins

PDB Compounds: (A:) Myoglobin

SCOP Domain Sequences for d2evka1:

Sequence; same for both SEQRES and ATOM records:

>d2evka1 a.1.1.2 (A:1-152) Myoglobin {Sperm whale (Physeter catodon) [TaxId: 9755]}
vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased
lkkhgvtvltalgailkkkghheaelkplaqsgatkhkipikylefiseaiihvlhsrhp
gdfgadaqgamnkalelfrkdiaakykelgyq

Timeline for d2evka1:

• d2evka1 is new in SCOP 1.73
  
• d2evka1 appears in SCOP 1.75
  
• d2evka1 appears in the current release, SCOPe 2.08, called d2evka_