SCOPe 2.06: Domain d2evda_: 2evd A:

Lineage for d2evda_ (2evd A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.224: Glycolipid transfer protein, GLTP [110003] (1 superfamily)
   multihelical; 2 layers or orthogonally packed helices

4. Superfamily a.224.1: Glycolipid transfer protein, GLTP [110004] (1 family)

5. Family a.224.1.1: Glycolipid transfer protein, GLTP [110005] (2 proteins)

6. Protein Glycolipid transfer protein, GLTP [110006] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [110007] (20 PDB entries)
   Uniprot Q9NZD2

8. Domain d2evda_: 2evd A: [132426]
   automated match to d1sx6a_
   complexed with d10, dao, lat, oct, sph

Details for d2evda_

PDB Entry: 2evd, 2 Å

PDB Description: crystal structure of human glycolipid transfer protein complexed with 12:0 lactosylceramide

PDB Compounds: (A:) glycolipid transfer protein

SCOPe Domain Sequences for d2evda_:

Sequence, based on SEQRES records:

>d2evda_ a.224.1.1 (A:) Glycolipid transfer protein, GLTP {Human (Homo sapiens) [TaxId: 9606]}
laehllkplpadkqietgpfleavshlppffdclgspvftpikadisgnitkikavydtn
pakfrtlqnilevekemygaewpkvgatlalmwlkrglrfiqvflqsicdgerdenhpnl
irvnatkayemalkkyhgwivqkifqaalyaapyksdflkalskgqnvteeeclekirlf
lvnytatidviyemytqmnaelnykv

Sequence, based on observed residues (ATOM records):

>d2evda_ a.224.1.1 (A:) Glycolipid transfer protein, GLTP {Human (Homo sapiens) [TaxId: 9606]}
laehllkplpadkqietgpfleavshlppffdclgspvftpikadisgnitkikavydtn
pakfrtlqnilevekemygaewpkvgatlalmwlkrglrfiqvflqsicdgerdenhpnl
irvnatkayemalkkyhgwivqkifqaalyaapyksdflkalsqnvteeeclekirlflv
nytatidviyemytqmnaelnykv

Timeline for d2evda_:

• d2evda_ first appeared in SCOP 1.73, called d2evda1
  
• d2evda_ appears in SCOPe 2.05
  
• d2evda_ appears in SCOPe 2.07
  
• d2evda_ appears in the current release, SCOPe 2.08