Lineage for d2evda1 (2evd A:4-209)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 651452Fold a.224: Glycolipid transfer protein, GLTP [110003] (1 superfamily)
    multihelical; 2 layers or orthogonally packed helices
  4. 651453Superfamily a.224.1: Glycolipid transfer protein, GLTP [110004] (1 family) (S)
  5. 651454Family a.224.1.1: Glycolipid transfer protein, GLTP [110005] (1 protein)
  6. 651455Protein Glycolipid transfer protein, GLTP [110006] (1 species)
  7. 651456Species Human (Homo sapiens) [TaxId:9606] [110007] (7 PDB entries)
  8. 651460Domain d2evda1: 2evd A:4-209 [132426]
    automatically matched to d1sx6a_
    complexed with d10, dao, lat, oct, sph

Details for d2evda1

PDB Entry: 2evd (more details), 2 Å

PDB Description: crystal structure of human glycolipid transfer protein complexed with 12:0 lactosylceramide
PDB Compounds: (A:) glycolipid transfer protein

SCOP Domain Sequences for d2evda1:

Sequence, based on SEQRES records: (download)

>d2evda1 a.224.1.1 (A:4-209) Glycolipid transfer protein, GLTP {Human (Homo sapiens) [TaxId: 9606]}
laehllkplpadkqietgpfleavshlppffdclgspvftpikadisgnitkikavydtn
pakfrtlqnilevekemygaewpkvgatlalmwlkrglrfiqvflqsicdgerdenhpnl
irvnatkayemalkkyhgwivqkifqaalyaapyksdflkalskgqnvteeeclekirlf
lvnytatidviyemytqmnaelnykv

Sequence, based on observed residues (ATOM records): (download)

>d2evda1 a.224.1.1 (A:4-209) Glycolipid transfer protein, GLTP {Human (Homo sapiens) [TaxId: 9606]}
laehllkplpadkqietgpfleavshlppffdclgspvftpikadisgnitkikavydtn
pakfrtlqnilevekemygaewpkvgatlalmwlkrglrfiqvflqsicdgerdenhpnl
irvnatkayemalkkyhgwivqkifqaalyaapyksdflkalsqnvteeeclekirlflv
nytatidviyemytqmnaelnykv

SCOP Domain Coordinates for d2evda1:

Click to download the PDB-style file with coordinates for d2evda1.
(The format of our PDB-style files is described here.)

Timeline for d2evda1: