SCOP 1.75: Domain d2ev6b2: 2ev6 B:63-136

Lineage for d2ev6b2 (2ev6 B:63-136)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.76: Iron-dependent repressor protein, dimerization domain [47978] (1 superfamily)
   6 helices, homodimer of 3-helical domains

4. Superfamily a.76.1: Iron-dependent repressor protein, dimerization domain [47979] (1 family)

5. Family a.76.1.1: Iron-dependent repressor protein, dimerization domain [47980] (3 proteins)

6. Protein Manganese transport regulator MntR [89086] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [89087] (11 PDB entries)

8. Domain d2ev6b2: 2ev6 B:63-136 [132424]
   Other proteins in same PDB: d2ev6a1, d2ev6b1
   automatically matched to d1on1a2
   complexed with flc, gol, zn

Details for d2ev6b2

PDB Entry: 2ev6, 1.7 Å

PDB Description: Bacillus subtilis manganese transport regulator (MNTR) bound to zinc

PDB Compounds: (B:) Transcriptional regulator mntR

SCOP Domain Sequences for d2ev6b2:

Sequence; same for both SEQRES and ATOM records:

>d2ev6b2 a.76.1.1 (B:63-136) Manganese transport regulator MntR {Bacillus subtilis [TaxId: 1423]}
tskgkkigkrlvyrhelleqflriigvdeekiyndvegiehhlswnsidrigdlvqyfee
ddarkkdlksiqkk

Timeline for d2ev6b2:

• d2ev6b2 first appeared in SCOP 1.73
  
• d2ev6b2 appears in SCOPe 2.01
  
• d2ev6b2 appears in the current release, SCOPe 2.08