Lineage for d2ev6b1 (2ev6 B:4-62)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. Family a.4.5.24: Iron-dependent repressor protein [46882] (4 proteins)
    automatically mapped to Pfam PF01325
  6. Protein Manganese transport regulator MntR [88986] (1 species)
  7. Species Bacillus subtilis [TaxId:1423] [88987] (11 PDB entries)
  8. Domain d2ev6b1: 2ev6 B:4-62 [132423]
    Other proteins in same PDB: d2ev6a2, d2ev6b2
    automated match to d1on1a1
    complexed with flc, gol, zn

Details for d2ev6b1

PDB Entry: 2ev6 (more details), 1.7 Å

PDB Description: Bacillus subtilis manganese transport regulator (MNTR) bound to zinc
PDB Compounds: (B:) Transcriptional regulator mntR

SCOPe Domain Sequences for d2ev6b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ev6b1 a.4.5.24 (B:4-62) Manganese transport regulator MntR {Bacillus subtilis [TaxId: 1423]}
psmedyieqiymlieekgyarvsdiaealavhpssvtkmvqkldkdeyliyekyrglvl

SCOPe Domain Coordinates for d2ev6b1 are not available.

Timeline for d2ev6b1:

Domains from same chain:
(mouse over for more information)
d2ev6b2
Domains from other chains:
(mouse over for more information)
d2ev6a1, d2ev6a2