![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (84 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.24: Iron-dependent repressor protein [46882] (3 proteins) |
![]() | Protein Manganese transport regulator MntR [88986] (1 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [88987] (11 PDB entries) |
![]() | Domain d2ev5a1: 2ev5 A:3-62 [132417] Other proteins in same PDB: d2ev5a2, d2ev5b2 automatically matched to d1on1a1 complexed with ca |
PDB Entry: 2ev5 (more details), 2 Å
SCOP Domain Sequences for d2ev5a1:
Sequence, based on SEQRES records: (download)
>d2ev5a1 a.4.5.24 (A:3-62) Manganese transport regulator MntR {Bacillus subtilis [TaxId: 1423]} tpsmedyieqiymlieekgyarvsdiaealavhpssvtkmvqkldkdeyliyekyrglvl
>d2ev5a1 a.4.5.24 (A:3-62) Manganese transport regulator MntR {Bacillus subtilis [TaxId: 1423]} tpsmedyieqiymlieekgyarvsdiaealavhpssvtkmvqkldkdeyliyglvl
Timeline for d2ev5a1: