Lineage for d2ev0b2 (2ev0 B:63-136)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2331932Fold a.76: Iron-dependent repressor protein, dimerization domain [47978] (1 superfamily)
    6 helices, homodimer of 3-helical domains
  4. 2331933Superfamily a.76.1: Iron-dependent repressor protein, dimerization domain [47979] (2 families) (S)
    automatically mapped to Pfam PF02742
  5. 2331934Family a.76.1.1: Iron-dependent repressor protein, dimerization domain [47980] (4 proteins)
  6. 2331995Protein Manganese transport regulator MntR [89086] (1 species)
  7. 2331996Species Bacillus subtilis [TaxId:1423] [89087] (11 PDB entries)
  8. 2331998Domain d2ev0b2: 2ev0 B:63-136 [132416]
    Other proteins in same PDB: d2ev0a1, d2ev0b1
    automated match to d1on1a2
    complexed with cd

Details for d2ev0b2

PDB Entry: 2ev0 (more details), 1.65 Å

PDB Description: Bacillus subtilis manganese transport regulator (MNTR) bound to cadmium
PDB Compounds: (B:) Transcriptional regulator mntR

SCOPe Domain Sequences for d2ev0b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ev0b2 a.76.1.1 (B:63-136) Manganese transport regulator MntR {Bacillus subtilis [TaxId: 1423]}
tskgkkigkrlvyrhelleqflriigvdeekiyndvegiehhlswnsidrigdlvqyfee
ddarkkdlksiqkk

SCOPe Domain Coordinates for d2ev0b2:

Click to download the PDB-style file with coordinates for d2ev0b2.
(The format of our PDB-style files is described here.)

Timeline for d2ev0b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ev0b1