Lineage for d2ev0b1 (2ev0 B:2-62)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2693576Family a.4.5.24: Iron-dependent repressor protein [46882] (4 proteins)
    automatically mapped to Pfam PF01325
  6. 2693637Protein Manganese transport regulator MntR [88986] (1 species)
  7. 2693638Species Bacillus subtilis [TaxId:1423] [88987] (11 PDB entries)
  8. 2693640Domain d2ev0b1: 2ev0 B:2-62 [132415]
    Other proteins in same PDB: d2ev0a2, d2ev0b2
    automated match to d1on1a1
    complexed with cd

Details for d2ev0b1

PDB Entry: 2ev0 (more details), 1.65 Å

PDB Description: Bacillus subtilis manganese transport regulator (MNTR) bound to cadmium
PDB Compounds: (B:) Transcriptional regulator mntR

SCOPe Domain Sequences for d2ev0b1:

Sequence, based on SEQRES records: (download)

>d2ev0b1 a.4.5.24 (B:2-62) Manganese transport regulator MntR {Bacillus subtilis [TaxId: 1423]}
ttpsmedyieqiymlieekgyarvsdiaealavhpssvtkmvqkldkdeyliyekyrglv
l

Sequence, based on observed residues (ATOM records): (download)

>d2ev0b1 a.4.5.24 (B:2-62) Manganese transport regulator MntR {Bacillus subtilis [TaxId: 1423]}
ttpsmedyieqiymlieekgyarvsdiaealavhpssvtkmvqkldkdeyliyglvl

SCOPe Domain Coordinates for d2ev0b1:

Click to download the PDB-style file with coordinates for d2ev0b1.
(The format of our PDB-style files is described here.)

Timeline for d2ev0b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ev0b2