Lineage for d2euwa1 (2euw A:33-335)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 789808Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 790093Superfamily b.2.5: p53-like transcription factors [49417] (7 families) (S)
  5. 790268Family b.2.5.7: DNA-binding domain from NDT80 [81992] (1 protein)
  6. 790269Protein DNA-binding domain from NDT80 [81993] (1 species)
    common fold is decorated with many additional structures
  7. 790270Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81994] (14 PDB entries)
  8. 790276Domain d2euwa1: 2euw A:33-335 [132410]
    automatically matched to d1mnna_
    mutant

Details for d2euwa1

PDB Entry: 2euw (more details), 1.68 Å

PDB Description: structure of a ndt80-dna complex (mse mutant ma4t)
PDB Compounds: (A:) NDT80 protein

SCOP Domain Sequences for d2euwa1:

Sequence, based on SEQRES records: (download)

>d2euwa1 b.2.5.7 (A:33-335) DNA-binding domain from NDT80 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
viltqlnedgttsnyfdkrklkiaprstlqfkvgppfelvrdycpvveshtgrtldlrii
pridrgfdhideewvgykrnyftlvstfetancdldtflkssfdllvedssvegrlrvqy
faikikaknddddteinlvqhtakrdkgpqfcpsvcplvpsplpkhqtireasnvrnitk
mkkydstfylhrdhvnyeeygvdsllfsypedsiqkvaryervqfassisvkkpsqqnkh
fslhvilgavvdpdtfhgenpgipydelalkngskgmfvylqemktppliirgrspsnya
ssq

Sequence, based on observed residues (ATOM records): (download)

>d2euwa1 b.2.5.7 (A:33-335) DNA-binding domain from NDT80 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
viltqlnedgttsnyfdkrklkiaprstlqfkvgppfelvrdycpvveshtgrtldlrii
pridrgfdhideewvgykrnyftlvstfetancdldtflkssfdllvgrlrvqyfaikik
aknddddteinlvqhtakrdkgpqfcpsvcplvpsplpkhqtireasnvrnitkmkkyds
tfylhrdhvnyeeygvdsllfsypedsiqkvaryervqfassisvkkpsqqnkhfslhvi
lgavvdpdgipydelalkngskgmfvylqemktppliirgrspsnyassq

SCOP Domain Coordinates for d2euwa1:

Click to download the PDB-style file with coordinates for d2euwa1.
(The format of our PDB-style files is described here.)

Timeline for d2euwa1: