Lineage for d2eulc2 (2eul C:78-156)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 720425Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 720426Superfamily d.26.1: FKBP-like [54534] (3 families) (S)
  5. 720582Family d.26.1.2: GreA transcript cleavage factor, C-terminal domain [54549] (1 protein)
  6. 720583Protein GreA transcript cleavage factor, C-terminal domain [54550] (3 species)
    N-terminal domain is a long alpha-hairpin
  7. 720590Species Thermus thermophilus [TaxId:274] [143118] (2 PDB entries)
  8. 720595Domain d2eulc2: 2eul C:78-156 [132397]
    Other proteins in same PDB: d2eula1, d2eulb1, d2eulc1, d2euld1
    automatically matched to 2EUL A:78-156
    complexed with zn

Details for d2eulc2

PDB Entry: 2eul (more details), 2.4 Å

PDB Description: structure of the transcription factor gfh1.
PDB Compounds: (C:) anti-cleavage anti-GreA transcription factor Gfh1

SCOP Domain Sequences for d2eulc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eulc2 d.26.1.2 (C:78-156) GreA transcript cleavage factor, C-terminal domain {Thermus thermophilus [TaxId: 274]}
gsgeviglgsvveledplsgerlsvqvvspaeanvldtpmkisdaspmgkallghrvgdv
lsldtpkgrrefrvvaihg

SCOP Domain Coordinates for d2eulc2:

Click to download the PDB-style file with coordinates for d2eulc2.
(The format of our PDB-style files is described here.)

Timeline for d2eulc2: