![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.26: FKBP-like [54533] (3 superfamilies) core: beta(2)-alpha-beta(2); antiparallel beta-sheet |
![]() | Superfamily d.26.1: FKBP-like [54534] (4 families) ![]() |
![]() | Family d.26.1.2: GreA transcript cleavage factor, C-terminal domain [54549] (1 protein) automatically mapped to Pfam PF01272 |
![]() | Protein GreA transcript cleavage factor, C-terminal domain [54550] (3 species) N-terminal domain is a long alpha-hairpin |
![]() | Species Thermus thermophilus [TaxId:274] [143118] (2 PDB entries) Uniprot Q5SJG6 78-156! Uniprot Q72JT8 78-156 |
![]() | Domain d2eulb2: 2eul B:78-156 [132395] Other proteins in same PDB: d2eula1, d2eulb1, d2eulc1, d2euld1 automated match to d2eula2 complexed with zn |
PDB Entry: 2eul (more details), 2.4 Å
SCOPe Domain Sequences for d2eulb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2eulb2 d.26.1.2 (B:78-156) GreA transcript cleavage factor, C-terminal domain {Thermus thermophilus [TaxId: 274]} gsgeviglgsvveledplsgerlsvqvvspaeanvldtpmkisdaspmgkallghrvgdv lsldtpkgrrefrvvaihg
Timeline for d2eulb2: