Lineage for d2eula2 (2eul A:78-156)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1408347Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 1408348Superfamily d.26.1: FKBP-like [54534] (4 families) (S)
  5. 1408608Family d.26.1.2: GreA transcript cleavage factor, C-terminal domain [54549] (1 protein)
    automatically mapped to Pfam PF01272
  6. 1408609Protein GreA transcript cleavage factor, C-terminal domain [54550] (3 species)
    N-terminal domain is a long alpha-hairpin
  7. 1408616Species Thermus thermophilus [TaxId:274] [143118] (2 PDB entries)
    Uniprot Q5SJG6 78-156! Uniprot Q72JT8 78-156
  8. 1408619Domain d2eula2: 2eul A:78-156 [132393]
    Other proteins in same PDB: d2eula1, d2eulb1, d2eulc1, d2euld1
    complexed with zn

Details for d2eula2

PDB Entry: 2eul (more details), 2.4 Å

PDB Description: structure of the transcription factor gfh1.
PDB Compounds: (A:) anti-cleavage anti-GreA transcription factor Gfh1

SCOPe Domain Sequences for d2eula2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eula2 d.26.1.2 (A:78-156) GreA transcript cleavage factor, C-terminal domain {Thermus thermophilus [TaxId: 274]}
gsgeviglgsvveledplsgerlsvqvvspaeanvldtpmkisdaspmgkallghrvgdv
lsldtpkgrrefrvvaihg

SCOPe Domain Coordinates for d2eula2:

Click to download the PDB-style file with coordinates for d2eula2.
(The format of our PDB-style files is described here.)

Timeline for d2eula2: