Lineage for d2euka1 (2euk A:4-209)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 780620Fold a.224: Glycolipid transfer protein, GLTP [110003] (1 superfamily)
    multihelical; 2 layers or orthogonally packed helices
  4. 780621Superfamily a.224.1: Glycolipid transfer protein, GLTP [110004] (1 family) (S)
  5. 780622Family a.224.1.1: Glycolipid transfer protein, GLTP [110005] (1 protein)
  6. 780623Protein Glycolipid transfer protein, GLTP [110006] (1 species)
  7. 780624Species Human (Homo sapiens) [TaxId:9606] [110007] (7 PDB entries)
    Uniprot Q9NZD2
  8. 780626Domain d2euka1: 2euk A:4-209 [132391]
    automatically matched to d1sx6a_
    complexed with gal, ner, oct, sph

Details for d2euka1

PDB Entry: 2euk (more details), 1.85 Å

PDB Description: crystal structure of human glycolipid transfer protein complexed with 24:1 galactosylceramide
PDB Compounds: (A:) glycolipid transfer protein

SCOP Domain Sequences for d2euka1:

Sequence, based on SEQRES records: (download)

>d2euka1 a.224.1.1 (A:4-209) Glycolipid transfer protein, GLTP {Human (Homo sapiens) [TaxId: 9606]}
laehllkplpadkqietgpfleavshlppffdclgspvftpikadisgnitkikavydtn
pakfrtlqnilevekemygaewpkvgatlalmwlkrglrfiqvflqsicdgerdenhpnl
irvnatkayemalkkyhgwivqkifqaalyaapyksdflkalskgqnvteeeclekirlf
lvnytatidviyemytqmnaelnykv

Sequence, based on observed residues (ATOM records): (download)

>d2euka1 a.224.1.1 (A:4-209) Glycolipid transfer protein, GLTP {Human (Homo sapiens) [TaxId: 9606]}
laehllkplpadkqietgpfleavshlppffdclgspvftpikadisgnitkikavydtn
pakfrtlqnilevekemygaewpkvgatlalmwlkrglrfiqvflqsicdgerdenhpnl
irvnatkayemalkkyhgwivqkifqaalyaapyksdflkalsqnvteeeclekirlflv
nytatidviyemytqmnaelnykv

SCOP Domain Coordinates for d2euka1:

Click to download the PDB-style file with coordinates for d2euka1.
(The format of our PDB-style files is described here.)

Timeline for d2euka1: