SCOP 1.73: Domain d2euie1: 2eui E:1-151

Lineage for d2euie1 (2eui E:1-151)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (9 families)

5. Family d.108.1.1: N-acetyl transferase, NAT [55730] (56 proteins)

6. Protein Probable acetyltransferase PA4026 [143692] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [143693] (1 PDB entry)

8. Domain d2euie1: 2eui E:1-151 [132390]
   automatically matched to 2EUI A:1-153

Details for d2euie1

PDB Entry: 2eui, 2.8 Å

PDB Description: crystal structure of a probable acetyltransferase

PDB Compounds: (E:) Probable acetyltransferase

SCOP Domain Sequences for d2euie1:

Sequence; same for both SEQRES and ATOM records:

>d2euie1 d.108.1.1 (E:1-151) Probable acetyltransferase PA4026 {Pseudomonas aeruginosa [TaxId: 287]}
mrivqatlehldllaplfvkyrefygmlsypessrkflekrlrrkesviylaladeedrl
lgfcqlypsfsslslkrvwilndiyvaeearrqlvadhllqhakqmarethavrmrvsts
vdnevaqkvyesigfredqefknytlpisde

Timeline for d2euie1:

• d2euie1 is new in SCOP 1.73
  
• d2euie1 appears in SCOP 1.75
  
• d2euie1 appears in the current release, SCOPe 2.08, called d2euie_