SCOPe 2.08: Domain d2euab_: 2eua B:

Lineage for d2euab_ (2eua B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.161: ADC synthase [56321] (1 superfamily)
   duplication: contains four repeats of alpha-beta(2)-beta motif arranged in a 4 layer core structure: alpha/beta/beta/alpha; orthogonally packed beta-sheets

4. Superfamily d.161.1: ADC synthase [56322] (2 families)
   the active site is formed by additional structures inserted into the core structure

5. Family d.161.1.1: ADC synthase [56323] (6 proteins)

6. Protein Menaquinone-specific isochorismate synthase MenF [143941] (1 species)

7. Species Escherichia coli [TaxId:562] [143942] (1 PDB entry)
   Uniprot P38051 2-429

8. Domain d2euab_: 2eua B: [132381]
   automated match to d2euaa1
   complexed with tar

Details for d2euab_

PDB Entry: 2eua, 2.5 Å

PDB Description: structure and mechanism of menf, the menaquinone-specific isochorismate synthase from escherichia coli

PDB Compounds: (B:) Menaquinone-specific isochorismate synthase

SCOPe Domain Sequences for d2euab_:

Sequence; same for both SEQRES and ATOM records:

>d2euab_ d.161.1.1 (B:) Menaquinone-specific isochorismate synthase MenF {Escherichia coli [TaxId: 562]}
qslttalenllrhlsqeipatpgirvidipfplkdafdalswlasqqtypqfywqqrngd
eeavvlgaitrftsldqaqrflrqhpehadlriwglnafdpsqgnlllprlewrrcggka
tlrltlfsesslqhdaiqakefiatlvsikplpglhltttreqhwpdktgwtqlielatk
tiaegeldkvvlaratdlhfaspvnaaammaasrrlnlncyhfymafdgenaflgssper
lwrrrdkalrtealagtvannpddkqaqqlgewlmaddknqrenmlvvedicqrlqadtq
tldvlppqvlrlrkvqhlrrciwtslnkaddviclhqlqptaavaglprdlarqfiarhe
pftrewyagsagylslqqsefcvslrsakisgnvvrlyagagivrgsdpeqewqeidnka
aglrtllq

Timeline for d2euab_:

• d2euab_ first appeared in SCOP 1.73, called d2euab1
  
• d2euab_ appears in SCOPe 2.07