Lineage for d2euaa1 (2eua A:2-429)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2604588Fold d.161: ADC synthase [56321] (1 superfamily)
    duplication: contains four repeats of alpha-beta(2)-beta motif arranged in a 4 layer core structure: alpha/beta/beta/alpha; orthogonally packed beta-sheets
  4. 2604589Superfamily d.161.1: ADC synthase [56322] (2 families) (S)
    the active site is formed by additional structures inserted into the core structure
  5. 2604590Family d.161.1.1: ADC synthase [56323] (6 proteins)
  6. 2604601Protein Menaquinone-specific isochorismate synthase MenF [143941] (1 species)
  7. 2604602Species Escherichia coli [TaxId:562] [143942] (1 PDB entry)
    Uniprot P38051 2-429
  8. 2604603Domain d2euaa1: 2eua A:2-429 [132380]
    complexed with tar

Details for d2euaa1

PDB Entry: 2eua (more details), 2.5 Å

PDB Description: structure and mechanism of menf, the menaquinone-specific isochorismate synthase from escherichia coli
PDB Compounds: (A:) Menaquinone-specific isochorismate synthase

SCOPe Domain Sequences for d2euaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2euaa1 d.161.1.1 (A:2-429) Menaquinone-specific isochorismate synthase MenF {Escherichia coli [TaxId: 562]}
qslttalenllrhlsqeipatpgirvidipfplkdafdalswlasqqtypqfywqqrngd
eeavvlgaitrftsldqaqrflrqhpehadlriwglnafdpsqgnlllprlewrrcggka
tlrltlfsesslqhdaiqakefiatlvsikplpglhltttreqhwpdktgwtqlielatk
tiaegeldkvvlaratdlhfaspvnaaammaasrrlnlncyhfymafdgenaflgssper
lwrrrdkalrtealagtvannpddkqaqqlgewlmaddknqrenmlvvedicqrlqadtq
tldvlppqvlrlrkvqhlrrciwtslnkaddviclhqlqptaavaglprdlarqfiarhe
pftrewyagsagylslqqsefcvslrsakisgnvvrlyagagivrgsdpeqewqeidnka
aglrtllq

SCOPe Domain Coordinates for d2euaa1:

Click to download the PDB-style file with coordinates for d2euaa1.
(The format of our PDB-style files is described here.)

Timeline for d2euaa1: