Lineage for d2eu7x1 (2eu7 X:2-179)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 673645Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 673646Superfamily b.60.1: Lipocalins [50814] (8 families) (S)
    bind hydrophobic ligands in their interior
  5. 673647Family b.60.1.1: Retinol binding protein-like [50815] (20 proteins)
    barrel, closed; n=8, S=12, meander
  6. 673795Protein Nitrophorin 2 (prolixin-s) [50843] (1 species)
  7. 673796Species Rhodnius prolixus [TaxId:13249] [50844] (14 PDB entries)
  8. 673798Domain d2eu7x1: 2eu7 X:2-179 [132379]
    automatically matched to d1euoa_
    complexed with hem, nh3; mutant

Details for d2eu7x1

PDB Entry: 2eu7 (more details), 1.2 Å

PDB Description: crystal structure of d1a mutant of nitrophorin 2 complexed with ammonia
PDB Compounds: (X:) Nitrophorin 2

SCOP Domain Sequences for d2eu7x1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eu7x1 b.60.1.1 (X:2-179) Nitrophorin 2 (prolixin-s) {Rhodnius prolixus [TaxId: 13249]}
cstnispkqgldkakyfsgkwyvthfldkdpqvtdqycssftpresdgtvkealyhynan
kktsfynigegklessglqytakyktvdkkkavlkeadeknsytltvleaddssalvhic
lregskdlgdlytvlthqkdaepsakvksavtqaglqlsqfvgtkdlgcqyddqftsl

SCOP Domain Coordinates for d2eu7x1:

Click to download the PDB-style file with coordinates for d2eu7x1.
(The format of our PDB-style files is described here.)

Timeline for d2eu7x1: