Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.93: SH2-like [55549] (1 superfamily) 3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices |
Superfamily d.93.1: SH2 domain [55550] (1 family) |
Family d.93.1.1: SH2 domain [55551] (32 proteins) Pfam PF00017 |
Protein Itk/tsk protein tyrosine kinase [82743] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [82744] (6 PDB entries) |
Domain d2eu0a1: 2eu0 A:4-111 [132376] automatically matched to d1luia_ complexed with ace, nh2 |
PDB Entry: 2eu0 (more details)
SCOP Domain Sequences for d2eu0a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2eu0a1 d.93.1.1 (A:4-111) Itk/tsk protein tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} nnletyewynksisrdkaekllldtgkegafmvrdsrtpgtytvsvftkaiisenpcikh yhiketndspkryyvaekyvfdsiplliqyhqynggglvtrlrypvcg
Timeline for d2eu0a1: