Lineage for d2eu0a1 (2eu0 A:4-111)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 729699Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices
  4. 729700Superfamily d.93.1: SH2 domain [55550] (1 family) (S)
  5. 729701Family d.93.1.1: SH2 domain [55551] (32 proteins)
    Pfam PF00017
  6. 729893Protein Itk/tsk protein tyrosine kinase [82743] (1 species)
  7. 729894Species Mouse (Mus musculus) [TaxId:10090] [82744] (6 PDB entries)
  8. 729897Domain d2eu0a1: 2eu0 A:4-111 [132376]
    automatically matched to d1luia_
    complexed with ace, nh2

Details for d2eu0a1

PDB Entry: 2eu0 (more details)

PDB Description: the nmr ensemble structure of the itk sh2 domain bound to a phosphopeptide
PDB Compounds: (A:) Tyrosine-protein kinase ITK/TSK

SCOP Domain Sequences for d2eu0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eu0a1 d.93.1.1 (A:4-111) Itk/tsk protein tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]}
nnletyewynksisrdkaekllldtgkegafmvrdsrtpgtytvsvftkaiisenpcikh
yhiketndspkryyvaekyvfdsiplliqyhqynggglvtrlrypvcg

SCOP Domain Coordinates for d2eu0a1:

Click to download the PDB-style file with coordinates for d2eu0a1.
(The format of our PDB-style files is described here.)

Timeline for d2eu0a1: