SCOPe 2.07: Domain d2etza1: 2etz A:4-110

Lineage for d2etza1 (2etz A:4-110)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (2 families)

5. Family d.93.1.1: SH2 domain [55551] (35 proteins)
   Pfam PF00017

6. Protein Itk/tsk protein tyrosine kinase [82743] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [82744] (8 PDB entries)

8. Domain d2etza1: 2etz A:4-110 [132375]
   Other proteins in same PDB: d2etza2
   automatically matched to d1luia_

Details for d2etza1

PDB Entry: 2etz

PDB Description: the nmr minimized average structure of the itk sh2 domain bound to a phosphopeptide

PDB Compounds: (A:) Tyrosine-protein kinase ITK/TSK

SCOPe Domain Sequences for d2etza1:

Sequence; same for both SEQRES and ATOM records:

>d2etza1 d.93.1.1 (A:4-110) Itk/tsk protein tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]}
nnletyewynksisrdkaekllldtgkegafmvrdsrtpgtytvsvftkaiisenpcikh
yhiketndspkryyvaekyvfdsiplliqyhqynggglvtrlrypvc

Timeline for d2etza1:

• d2etza1 first appeared in SCOP 1.73
  
• d2etza1 appears in SCOPe 2.06
  
• d2etza1 appears in the current release, SCOPe 2.08