Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.93: SH2-like [55549] (1 superfamily) 3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices |
Superfamily d.93.1: SH2 domain [55550] (2 families) |
Family d.93.1.1: SH2 domain [55551] (35 proteins) Pfam PF00017 |
Protein Itk/tsk protein tyrosine kinase [82743] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [82744] (8 PDB entries) |
Domain d2etza1: 2etz A:4-110 [132375] Other proteins in same PDB: d2etza2 automatically matched to d1luia_ |
PDB Entry: 2etz (more details)
SCOPe Domain Sequences for d2etza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2etza1 d.93.1.1 (A:4-110) Itk/tsk protein tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} nnletyewynksisrdkaekllldtgkegafmvrdsrtpgtytvsvftkaiisenpcikh yhiketndspkryyvaekyvfdsiplliqyhqynggglvtrlrypvc
Timeline for d2etza1: