Lineage for d2etsa1 (2ets A:1-110)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1988268Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 1989354Superfamily a.24.26: YppE-like [140415] (1 family) (S)
    flattened bundle at one end with helices 2 and coming in contact and separating helices 1 and 3
    automatically mapped to Pfam PF08807
  5. 1989355Family a.24.26.1: YppE-like [140416] (3 proteins)
    Pfam PF08807; DUF1798
  6. 1989359Protein Hypothetical protein MW1337 [140419] (1 species)
    SA1281 ortholog
  7. 1989360Species Staphylococcus aureus [TaxId:1280] [140420] (1 PDB entry)
    Uniprot Q8NWP7 1-110
  8. 1989361Domain d2etsa1: 2ets A:1-110 [132371]
    Other proteins in same PDB: d2etsa2
    complexed with cl, po4

Details for d2etsa1

PDB Entry: 2ets (more details), 2.25 Å

PDB Description: crystal structure of a bacterial domain of unknown function from duf1798 family (mw1337) from staphylococcus aureus subsp. aureus at 2.25 a resolution
PDB Compounds: (A:) hypothetical protein

SCOPe Domain Sequences for d2etsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2etsa1 a.24.26.1 (A:1-110) Hypothetical protein MW1337 {Staphylococcus aureus [TaxId: 1280]}
mndlvesliyevnnmqqnfenvksqqqdhdfyqtvkpytehidsilneiklhrefiievp
ymnsrkfellianieqlsvechfkrtsrklfieklksvqydlqnildgvt

SCOPe Domain Coordinates for d2etsa1:

Click to download the PDB-style file with coordinates for d2etsa1.
(The format of our PDB-style files is described here.)

Timeline for d2etsa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2etsa2