![]() | Class a: All alpha proteins [46456] (286 folds) |
![]() | Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
![]() | Superfamily a.24.26: YppE-like [140415] (1 family) ![]() flattened bundle at one end with helices 2 and coming in contact and separating helices 1 and 3 automatically mapped to Pfam PF08807 |
![]() | Family a.24.26.1: YppE-like [140416] (3 proteins) Pfam PF08807; DUF1798 |
![]() | Protein Hypothetical protein MW1337 [140419] (1 species) SA1281 ortholog |
![]() | Species Staphylococcus aureus [TaxId:1280] [140420] (1 PDB entry) Uniprot Q8NWP7 1-110 |
![]() | Domain d2etsa1: 2ets A:1-110 [132371] complexed with cl, po4 |
PDB Entry: 2ets (more details), 2.25 Å
SCOPe Domain Sequences for d2etsa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2etsa1 a.24.26.1 (A:1-110) Hypothetical protein MW1337 {Staphylococcus aureus [TaxId: 1280]} mndlvesliyevnnmqqnfenvksqqqdhdfyqtvkpytehidsilneiklhrefiievp ymnsrkfellianieqlsvechfkrtsrklfieklksvqydlqnildgvt
Timeline for d2etsa1: