SCOPe 2.08: Domain d2etsa1: 2ets A:1-110

Lineage for d2etsa1 (2ets A:1-110)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.26: YppE-like [140415] (1 family)
   flattened bundle at one end with helices 2 and coming in contact and separating helices 1 and 3
   automatically mapped to Pfam PF08807

5. Family a.24.26.1: YppE-like [140416] (3 proteins)
   Pfam PF08807; DUF1798

6. Protein Hypothetical protein MW1337 [140419] (1 species)
   SA1281 ortholog

7. Species Staphylococcus aureus [TaxId:1280] [140420] (1 PDB entry)
   Uniprot Q8NWP7 1-110

8. Domain d2etsa1: 2ets A:1-110 [132371]
   Other proteins in same PDB: d2etsa2
   complexed with cl, po4

Details for d2etsa1

PDB Entry: 2ets, 2.25 Å

PDB Description: crystal structure of a bacterial domain of unknown function from duf1798 family (mw1337) from staphylococcus aureus subsp. aureus at 2.25 a resolution

PDB Compounds: (A:) hypothetical protein

SCOPe Domain Sequences for d2etsa1:

Sequence; same for both SEQRES and ATOM records:

>d2etsa1 a.24.26.1 (A:1-110) Hypothetical protein MW1337 {Staphylococcus aureus [TaxId: 1280]}
mndlvesliyevnnmqqnfenvksqqqdhdfyqtvkpytehidsilneiklhrefiievp
ymnsrkfellianieqlsvechfkrtsrklfieklksvqydlqnildgvt

Timeline for d2etsa1:

• d2etsa1 first appeared in SCOP 1.73
  
• d2etsa1 appears in SCOPe 2.07