SCOPe 2.03: Domain d2etnb2: 2etn B:78-156

Lineage for d2etnb2 (2etn B:78-156)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)
   core: beta(2)-alpha-beta(2); antiparallel beta-sheet

4. Superfamily d.26.1: FKBP-like [54534] (4 families)

5. Family d.26.1.2: GreA transcript cleavage factor, C-terminal domain [54549] (1 protein)
   automatically mapped to Pfam PF01272

6. Protein GreA transcript cleavage factor, C-terminal domain [54550] (3 species)
   N-terminal domain is a long alpha-hairpin

7. Species Thermus aquaticus [TaxId:271] [143117] (1 PDB entry)
   Uniprot Q8VQD7 78-156

8. Domain d2etnb2: 2etn B:78-156 [132368]
   Other proteins in same PDB: d2etna1, d2etnb1, d2etnc1
   automatically matched to 2ETN A:78-156

Details for d2etnb2

PDB Entry: 2etn, 3.3 Å

PDB Description: Crystal structure of Thermus aquaticus Gfh1

PDB Compounds: (B:) anti-cleavage anti-GreA transcription factor Gfh1

SCOPe Domain Sequences for d2etnb2:

Sequence; same for both SEQRES and ATOM records:

>d2etnb2 d.26.1.2 (B:78-156) GreA transcript cleavage factor, C-terminal domain {Thermus aquaticus [TaxId: 271]}
gtgeviglgsvveledpatgerlsvqvvspaeasvlenpmkisdaspmgkallghrvgdv
lsldtpkgkkefrvvaihg

Timeline for d2etnb2:

• d2etnb2 first appeared in SCOP 1.73
  
• d2etnb2 appears in SCOPe 2.02
  
• d2etnb2 appears in SCOPe 2.04
  
• d2etnb2 appears in the current release, SCOPe 2.08