Lineage for d2etnb2 (2etn B:78-156)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1022608Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 1022609Superfamily d.26.1: FKBP-like [54534] (4 families) (S)
  5. 1022787Family d.26.1.2: GreA transcript cleavage factor, C-terminal domain [54549] (1 protein)
  6. 1022788Protein GreA transcript cleavage factor, C-terminal domain [54550] (3 species)
    N-terminal domain is a long alpha-hairpin
  7. 1022791Species Thermus aquaticus [TaxId:271] [143117] (1 PDB entry)
    Uniprot Q8VQD7 78-156
  8. 1022793Domain d2etnb2: 2etn B:78-156 [132368]
    Other proteins in same PDB: d2etna1, d2etnb1, d2etnc1
    automatically matched to 2ETN A:78-156

Details for d2etnb2

PDB Entry: 2etn (more details), 3.3 Å

PDB Description: Crystal structure of Thermus aquaticus Gfh1
PDB Compounds: (B:) anti-cleavage anti-GreA transcription factor Gfh1

SCOPe Domain Sequences for d2etnb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2etnb2 d.26.1.2 (B:78-156) GreA transcript cleavage factor, C-terminal domain {Thermus aquaticus [TaxId: 271]}
gtgeviglgsvveledpatgerlsvqvvspaeasvlenpmkisdaspmgkallghrvgdv
lsldtpkgkkefrvvaihg

SCOPe Domain Coordinates for d2etnb2:

Click to download the PDB-style file with coordinates for d2etnb2.
(The format of our PDB-style files is described here.)

Timeline for d2etnb2: