Lineage for d2etna2 (2etn A:78-156)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1199823Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 1199824Superfamily d.26.1: FKBP-like [54534] (4 families) (S)
  5. 1200008Family d.26.1.2: GreA transcript cleavage factor, C-terminal domain [54549] (1 protein)
  6. 1200009Protein GreA transcript cleavage factor, C-terminal domain [54550] (3 species)
    N-terminal domain is a long alpha-hairpin
  7. 1200012Species Thermus aquaticus [TaxId:271] [143117] (1 PDB entry)
    Uniprot Q8VQD7 78-156
  8. 1200013Domain d2etna2: 2etn A:78-156 [132366]
    Other proteins in same PDB: d2etna1, d2etnb1, d2etnc1

Details for d2etna2

PDB Entry: 2etn (more details), 3.3 Å

PDB Description: Crystal structure of Thermus aquaticus Gfh1
PDB Compounds: (A:) anti-cleavage anti-GreA transcription factor Gfh1

SCOPe Domain Sequences for d2etna2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2etna2 d.26.1.2 (A:78-156) GreA transcript cleavage factor, C-terminal domain {Thermus aquaticus [TaxId: 271]}
gtgeviglgsvveledpatgerlsvqvvspaeasvlenpmkisdaspmgkallghrvgdv
lsldtpkgkkefrvvaihg

SCOPe Domain Coordinates for d2etna2:

Click to download the PDB-style file with coordinates for d2etna2.
(The format of our PDB-style files is described here.)

Timeline for d2etna2: