Lineage for d2etmb_ (2etm B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2542316Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2543741Protein Focal adhesion kinase 1 (fak) [103292] (2 species)
    PTK group; FAK subfamily; non-membrane spanning protein tyrosine kinase
  7. 2543745Species Human (Homo sapiens) [TaxId:9606] [103293] (16 PDB entries)
  8. 2543760Domain d2etmb_: 2etm B: [132364]
    automated match to d1mp8a_
    complexed with 7py

Details for d2etmb_

PDB Entry: 2etm (more details), 2.3 Å

PDB Description: Crystal Structure of Focal Adhesion Kinase Domain Complexed with 7H-Pyrrolo [2,3-d] pyrimidine Derivative
PDB Compounds: (B:) Focal adhesion kinase 1

SCOPe Domain Sequences for d2etmb_:

Sequence, based on SEQRES records: (download)

>d2etmb_ d.144.1.7 (B:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]}
rdyeiqrerielgrcigegqfgdvhqgiymspenpalavaiktcknctsdsvrekflqea
ltmrqfdhphivkligvitenpvwiimelctlgelrsflqvrkysldlaslilyayqlst
alayleskrfvhrdiaarnvlvssndcvklgdfglsrymedstyykaskgklpikwmape
sinfrrftsasdvwmfgvcmweilmhgvkpfqgvknndvigriengerlpmppncpptly
slmtkcwaydpsrrprftelkaqlstileeekaqqee

Sequence, based on observed residues (ATOM records): (download)

>d2etmb_ d.144.1.7 (B:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]}
rdyeiqrerielgrcigegqfgdvhqgiymspenpalavaiktcknctsdsvrekflqea
ltmrqfdhphivkligvitenpvwiimelctlgelrsflqvrkysldlaslilyayqlst
alayleskrfvhrdiaarnvlvssndcvklgdfglsrlpikwmapesinfrrftsasdvw
mfgvcmweilmhgvkpfqgvknndvigriengerlpmppncpptlyslmtkcwaydpsrr
prftelkaqlstileeekaqqee

SCOPe Domain Coordinates for d2etmb_:

Click to download the PDB-style file with coordinates for d2etmb_.
(The format of our PDB-style files is described here.)

Timeline for d2etmb_: