Lineage for d2etja1 (2etj A:1-221)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2885833Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) (S)
    consists of one domain of this fold
  5. 2885834Family c.55.3.1: Ribonuclease H [53099] (5 proteins)
  6. 2885870Protein Class II ribonuclease H (RNase HII) [53103] (5 species)
  7. 2885883Species Thermotoga maritima [TaxId:2336] [142489] (1 PDB entry)
    Uniprot Q9X017 1-221
  8. 2885884Domain d2etja1: 2etj A:1-221 [132360]
    complexed with cl, edo, mg
    has additional insertions and/or extensions that are not grouped together

Details for d2etja1

PDB Entry: 2etj (more details), 1.74 Å

PDB Description: crystal structure of ribonuclease hii (ec 3.1.26.4) (rnase hii) (tm0915) from thermotoga maritima at 1.74 a resolution
PDB Compounds: (A:) ribonuclease hii

SCOPe Domain Sequences for d2etja1:

Sequence, based on SEQRES records: (download)

>d2etja1 c.55.3.1 (A:1-221) Class II ribonuclease H (RNase HII) {Thermotoga maritima [TaxId: 2336]}
mgidelykkefgivagvdeagrgclagpvvaaavvlekeiegindskqlspakrerllde
imekaavgigiaspeeidlynifnatklamnralenlsvkpsfvlvdgkgielsvpgtcl
vkgdqkskligaasivakvfrdrlmsefhrmypqfsfhkhkgyatkehlneirkngvlpi
hrlsfepvlelltddllreffekglisenrferilnllgar

Sequence, based on observed residues (ATOM records): (download)

>d2etja1 c.55.3.1 (A:1-221) Class II ribonuclease H (RNase HII) {Thermotoga maritima [TaxId: 2336]}
mgidelykkefgivagvdeagrgclagpvvaaavvlekeieakrerlldeimekaavgig
iaspeeidlynifnatklamnralenlsvkpsfvlvdgkgielsvpgtclvkgdqkskli
gaasivakvfrdrlmsefhrmypqfsfhkhkgyatkehlneirkngvlpihrlsfepvle
lltddllreffekglisenrferilnllgar

SCOPe Domain Coordinates for d2etja1:

Click to download the PDB-style file with coordinates for d2etja1.
(The format of our PDB-style files is described here.)

Timeline for d2etja1: