Lineage for d2ethb_ (2eth B:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1257871Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1258750Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1259408Family a.4.5.28: MarR-like transcriptional regulators [63379] (20 proteins)
    The N- and C-terminal helical extensions to the common fold form the dimer interface
  6. 1259461Protein Putative transcriptional regulator TM0816 [140241] (1 species)
  7. 1259462Species Thermotoga maritima [TaxId:2336] [140242] (1 PDB entry)
    Uniprot Q9WZS3 1-140
  8. 1259464Domain d2ethb_: 2eth B: [132359]
    automated match to d2etha1
    complexed with cl

Details for d2ethb_

PDB Entry: 2eth (more details), 2.3 Å

PDB Description: Crystal structure of a marr-like transcriptional regulator (tm0816) from thermotoga maritima at 2.50 A resolution
PDB Compounds: (B:) transcriptional regulator, putative, Mar family

SCOPe Domain Sequences for d2ethb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ethb_ a.4.5.28 (B:) Putative transcriptional regulator TM0816 {Thermotoga maritima [TaxId: 2336]}
hmdaleifktlfslvmrfssylpsneeisdmkttelyaflyvalfgpkkmkeiaeflstt
ksnvtnvvdslekrglvvremdpvdrrtyrvvltekgkeifgeilsnfesllksvlekfs
eedfkvvsegfnrmvealsre

SCOPe Domain Coordinates for d2ethb_:

Click to download the PDB-style file with coordinates for d2ethb_.
(The format of our PDB-style files is described here.)

Timeline for d2ethb_: