Class a: All alpha proteins [46456] (284 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) contains a small beta-sheet (wing) |
Family a.4.5.28: MarR-like transcriptional regulators [63379] (20 proteins) The N- and C-terminal helical extensions to the common fold form the dimer interface |
Protein Putative transcriptional regulator TM0816 [140241] (1 species) |
Species Thermotoga maritima [TaxId:2336] [140242] (1 PDB entry) Uniprot Q9WZS3 1-140 |
Domain d2ethb_: 2eth B: [132359] automated match to d2etha1 complexed with cl |
PDB Entry: 2eth (more details), 2.3 Å
SCOPe Domain Sequences for d2ethb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ethb_ a.4.5.28 (B:) Putative transcriptional regulator TM0816 {Thermotoga maritima [TaxId: 2336]} hmdaleifktlfslvmrfssylpsneeisdmkttelyaflyvalfgpkkmkeiaeflstt ksnvtnvvdslekrglvvremdpvdrrtyrvvltekgkeifgeilsnfesllksvlekfs eedfkvvsegfnrmvealsre
Timeline for d2ethb_: