Lineage for d2etfb_ (2etf B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2528985Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2528986Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2529349Family d.92.1.7: Clostridium neurotoxins, catalytic domain [55512] (2 proteins)
  6. 2529350Protein Botulinum neurotoxin [55513] (4 species)
  7. 2529388Species Clostridium botulinum, serotype B [TaxId:1491] [55515] (17 PDB entries)
  8. 2529405Domain d2etfb_: 2etf B: [132357]
    automated match to d1f82a_
    complexed with so4, zn

Details for d2etfb_

PDB Entry: 2etf (more details), 2.29 Å

PDB Description: Crystal structure of full length botulinum neurotoxin (Type B) light chain
PDB Compounds: (B:) Botulinum neurotoxin B light chain

SCOPe Domain Sequences for d2etfb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2etfb_ d.92.1.7 (B:) Botulinum neurotoxin {Clostridium botulinum, serotype B [TaxId: 1491]}
pvtinnfnyndpidnnniimmeppfargtgryykafkitdriwiiperytfgykpedfnk
ssgifnrdvceyydpdylntndkkniflqtmiklfnrikskplgekllemiingipylgd
rrvpleefntniasvtvnklisnpgeverkkgifanliifgpgpvlnenetidigiqnhf
asregfggimqmkfcpeyvsvfnnvqenkgasifnrrgyfsdpalilmhelihvlhglyg
ikvddlpivpnekkffmqstdaiqaeelytfggqdpsiitpstdksiydkvlqnfrgivd
rlnkvlvcisdpnininiyknkfkdkykfvedsegkysidvesfdklykslmfgftetni
aenykiktrasyfsdslppvkiknlldneiytieegfnisdkdmekeyrgqnkainkqay
eeiskehlavykiqmck

SCOPe Domain Coordinates for d2etfb_:

Click to download the PDB-style file with coordinates for d2etfb_.
(The format of our PDB-style files is described here.)

Timeline for d2etfb_: