Lineage for d2eteb_ (2ete B:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 962884Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 962885Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 962963Family b.82.1.2: Germin/Seed storage 7S protein [51187] (5 proteins)
  6. 962974Protein Germin [63853] (1 species)
    Metal (manganese)-binding protein with oxalate oxidase and superoxide dismutase activities; homohexamer
  7. 962975Species Barley (Hordeum vulgare) [TaxId:4513] [63854] (4 PDB entries)
  8. 962980Domain d2eteb_: 2ete B: [132355]
    automated match to d1fi2a_
    complexed with glv, mn, nag

Details for d2eteb_

PDB Entry: 2ete (more details), 1.75 Å

PDB Description: recombinant oxalate oxidase in complex with glycolate
PDB Compounds: (B:) Oxalate oxidase 1

SCOPe Domain Sequences for d2eteb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eteb_ b.82.1.2 (B:) Germin {Barley (Hordeum vulgare) [TaxId: 4513]}
sdpdplqdfcvadldgkavsvnghtckpmseagddflfsskltkagntstpngsavteld
vaewpgtntlgvsmnrvdfapggtnpphihprateigmvmkgellvgilgsldsgnklys
rvvragetfviprglmhfqfnvgkteaymvvsfnsqnpgivfvpltlfgsdppiptpvlt
kalrveagvvellkskfaggs

SCOPe Domain Coordinates for d2eteb_:

Click to download the PDB-style file with coordinates for d2eteb_.
(The format of our PDB-style files is described here.)

Timeline for d2eteb_: