![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
![]() | Superfamily b.82.1: RmlC-like cupins [51182] (25 families) ![]() |
![]() | Family b.82.1.2: Germin/Seed storage 7S protein [51187] (5 proteins) has additional insertions and/or extensions that are not grouped together |
![]() | Protein Germin [63853] (1 species) Metal (manganese)-binding protein with oxalate oxidase and superoxide dismutase activities; homohexamer |
![]() | Species Barley (Hordeum vulgare) [TaxId:4513] [63854] (4 PDB entries) |
![]() | Domain d2eteb_: 2ete B: [132355] automated match to d1fi2a_ complexed with glv, mn, nag has additional insertions and/or extensions that are not grouped together |
PDB Entry: 2ete (more details), 1.75 Å
SCOPe Domain Sequences for d2eteb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2eteb_ b.82.1.2 (B:) Germin {Barley (Hordeum vulgare) [TaxId: 4513]} sdpdplqdfcvadldgkavsvnghtckpmseagddflfsskltkagntstpngsavteld vaewpgtntlgvsmnrvdfapggtnpphihprateigmvmkgellvgilgsldsgnklys rvvragetfviprglmhfqfnvgkteaymvvsfnsqnpgivfvpltlfgsdppiptpvlt kalrveagvvellkskfaggs
Timeline for d2eteb_: