SCOPe 2.08: Domain d2eteb_: 2ete B:

Lineage for d2eteb_ (2ete B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families)

5. Family b.82.1.2: Germin/Seed storage 7S protein [51187] (5 proteins)
   has additional insertions and/or extensions that are not grouped together
   

6. Protein Germin [63853] (1 species)
   Metal (manganese)-binding protein with oxalate oxidase and superoxide dismutase activities; homohexamer

7. Species Barley (Hordeum vulgare) [TaxId:4513] [63854] (4 PDB entries)

8. Domain d2eteb_: 2ete B: [132355]
   automated match to d1fi2a_
   complexed with glv, mn, nag
   has additional insertions and/or extensions that are not grouped together

Details for d2eteb_

PDB Entry: 2ete, 1.75 Å

PDB Description: recombinant oxalate oxidase in complex with glycolate

PDB Compounds: (B:) Oxalate oxidase 1

SCOPe Domain Sequences for d2eteb_:

Sequence; same for both SEQRES and ATOM records:

>d2eteb_ b.82.1.2 (B:) Germin {Barley (Hordeum vulgare) [TaxId: 4513]}
sdpdplqdfcvadldgkavsvnghtckpmseagddflfsskltkagntstpngsavteld
vaewpgtntlgvsmnrvdfapggtnpphihprateigmvmkgellvgilgsldsgnklys
rvvragetfviprglmhfqfnvgkteaymvvsfnsqnpgivfvpltlfgsdppiptpvlt
kalrveagvvellkskfaggs

Timeline for d2eteb_:

• d2eteb_ first appeared in SCOP 1.73, called d2eteb1
  
• d2eteb_ appears in SCOPe 2.07